VMware Workstation 7 Manuel d'utilisateur Page 437
- Page / 512
- Table des matières
- DEPANNAGE
- MARQUE LIVRES
Noté. / 5. Basé sur avis des utilisateurs
VMware, Inc. 437
Chapter 20 Deploying ACE Packages
Change Package Lifetime Settings for a Managed Package
IfyouusetheACEManagementServer,youcanchangethepackagelifetimesettings
ordeactivateapackageimmediately.
Beforeyoubegin,makesureWorkstationisconnectedtotheACEManagementServer.
Forinformationaboutinstallingandsettinguptheserver,seetheACEManagement
ServerAdministrator’sGuide.
To change package lifetime settings for a managed package
1 SelecttheACE‐e
nabledvirtualmac
hineandchooseView>CurrentView>
Summary.
2ClickthePackagessectiontab.
3Right‐clickthepackageanddooneofthefollowing:
TochangethepackagelifetimesettingschooseProperties>Settings.
TodeactivatethepackageimmediatelychooseDeactivate.
Instance Customization on Windows Guests Only
InstancecustomizationappliesonlytoACEinstancesthathaveaWindowsguest
operatingsysteminstalled.Theinstancecustomizationprocessisbuiltaroundthe
standardMicrosoftSysprepdeploymenttools.Itprovidesthefollowingbenefits:
AutomatestheSysprepprocess(theuseoftheMicrosoftSysprepdeployment
tools).ItgivesyoubettercontrolofsomeSysprepparameters,suchascomputer
name.
AutomatesjoiningACEinstancestoadomainfromaremotesite.See“SetUpa
RemoteDomainJoin”onpage 443.
FormanagedACEinstances,theinstancecustomizationprocessontheuser’s
machinereportsthesuccessorfailureoftheprocesstotheserver.Theinformation
isavailableintheinstanceviewofWorkstation.Besidesstatus,theprocessalso
reportstheMACaddressandthenewcomputername.
- Workstation User’s Manual 1
- 2 VMware, Inc 2
- 4 VMware, Inc 4
- VMware, Inc. 5 5
- Machine 133 6
- VMware, Inc. 7 7
- 8 VMware, Inc 8
- VMware, Inc. 9 9
- 13 ConfiguringTeams 271 10
- VMware, Inc. 11 11
- Contents 11
- 12 VMware, Inc 12
- 16 ConnectingDevices 331 13
- 14 VMware, Inc 14
- VMware, Inc. 15 15
- 20 DeployingACEPackages 435 16
- 21 PocketACE 457 16
- Glossary 489 17
- Index 495 17
- 18 VMware, Inc 18
- About This Book 19
- Online and Telephone Support 20
- Support Offerings 20
- VMware Professional Services 20
- Introduction and System 21
- Requirements 21
- Overview of This Manual 22
- Host System Requirements 23
- Disk Drives 24
- Local Area Networking 25
- Host Operating System 25
- 26 VMware, Inc 26
- Linux Host Operating Systems 27
- 28 VMware, Inc 28
- Processor 29
- Chip Set 29
- Graphics 30
- IDE Drives 30
- SCSI Devices 30
- VMware, Inc. 31 31
- Ethernet Card 32
- Virtual Networking 32
- VMware, Inc. 33 33
- 34 VMware, Inc 34
- VMware, Inc. 35 35
- 36 VMware, Inc 36
- VMware, Inc. 37 37
- 38 VMware, Inc 38
- Installing and Upgrading 39
- VMware Workstation 39
- 40 VMware, Inc 40
- VMware, Inc. 41 41
- Install Workstation Silently 42
- VMware, Inc. 43 43
- 44 VMware, Inc 44
- VMware, Inc. 45 45
- 46 VMware, Inc 46
- Preparing for an Upgrade 47
- 48 VMware, Inc 48
- VMware, Inc. 49 49
- Windows Vista or Windows 7 50
- Windows Vista 50
- 52 VMware, Inc 52
- Learning Workstation 53
- /usr/bin/vmware & 54
- VMware, Inc. 55 55
- Home Page and Views 56
- Summary View button 57
- Console View 58
- Appliance View 58
- Toolbar Buttons 59
- 60 VMware, Inc 60
- VMware, Inc. 61 61
- View the Sidebar 62
- Favorites List in the Sidebar 63
- 64 VMware, Inc 64
- Check for Product Updates 65
- 66 VMware, Inc 66
- VMware, Inc. 67 67
- 68 VMware, Inc 68
- Hardware Tab 69
- Options Tab 70
- General 71
- Keyboard Shortcuts 72
- VMware, Inc. 73 73
- 74 VMware, Inc 74
- VMware, Inc. 75 75
- Running the Support Script 76
- VMware, Inc. 77 77
- 78 VMware, Inc 78
- Creating and Upgrading a 79
- 80 VMware, Inc 80
- VMware, Inc. 81 81
- 82 VMware, Inc 82
- Number of Processors 84
- Memory Allocation 85
- Network Connection Type 85
- I/O Adapter Types 86
- Disk Types 86
- VMware, Inc. 87 87
- Disk Capacity 88
- VMware, Inc. 89 89
- 90 VMware, Inc 90
- VMware, Inc. 91 91
- 92 VMware, Inc 92
- VMware, Inc. 93 93
- 94 VMware, Inc 94
- VMware, Inc. 95 95
- Upgrading 96
- VMware, Inc. 97 97
- 98 VMware, Inc 98
- VMware, Inc. 99 99
- 100 VMware, Inc 100
- Installing and Using 101
- VMware Tools 101
- VMware Tools Service 102
- VMware Device Drivers 102
- VMware User Process 103
- Installing VMware Tools 104
- VMware, Inc. 105 105
- 106 VMware, Inc 106
- VMware, Inc. 107 107
- VMware, Inc. 109 109
- 110 VMware, Inc 110
- VMware, Inc. 111 111
- 112 VMware, Inc 112
- VMware, Inc. 113 113
- Session Manager 114
- VMware Tools Update Process 115
- 116 VMware, Inc 116
- VMware, Inc. 117 117
- Uninstall VMware Tools 118
- VMware, Inc. 119 119
- Options Tab Settings 120
- Configuration File 121
- Devices Tab Settings 122
- Scripts Tab Settings 122
- Shrink Tab Settings 123
- About Tab 123
- Table 5-3. vmwtool Commands 124
- VMware, Inc. 125 125
- 126 VMware, Inc 126
- VMware, Inc. 127 127
- Machine 128
- VMware, Inc. 129 129
- String in a Startup Command 130
- VMware, Inc. 131 131
- 132 VMware, Inc 132
- Creating a Virtual Machine 133
- Another Virtual Machine 133
- 134 VMware, Inc 134
- Supported Source Machines 135
- Physical Machine Source 136
- VMware, Inc. 137 137
- Dual-Boot System Source 138
- ESX Virtual Machine Source 138
- Supported Volume Types 139
- Disk Space Allocation 139
- Full or Linked Clones 139
- Supported Destinations 140
- Network Adapters 141
- Conversion Impact on Settings 142
- VMware, Inc. 143 143
- 144 VMware, Inc 144
- VMware, Inc. 145 145
- 146 VMware, Inc 146
- Getting Started with Virtual 147
- Machines 147
- Starting a Virtual Machine 148
- VMware, Inc. 149 149
- Virtual Machine Location 150
- Shut Down a Virtual Machine 151
- 152 VMware, Inc 152
- Download Components 153
- Pausing a Virtual Machine 154
- Encrypting a Virtual Machine 155
- Restrictions on Encryption 156
- Encrypt a Virtual Machine 156
- VMware, Inc. 157 157
- Delete a Virtual Machine 158
- VMware, Inc. 159 159
- 160 VMware, Inc 160
- Enter and Exit Unity Mode 161
- Use Full Screen Mode 162
- VMware, Inc. 163 163
- 164 VMware, Inc 164
- Use Quick Switch Mode 165
- Use Exclusive Mode 165
- 166 VMware, Inc 166
- VMware, Inc. 167 167
- 168 VMware, Inc 168
- VMware, Inc. 169 169
- 170 VMware, Inc 170
- VMware, Inc. 171 171
- Configuring Video and Sound 172
- Support for Direct3D Graphics 173
- 174 VMware, Inc 174
- Configuring Sound 175
- 176 VMware, Inc 176
- VMware, Inc. 177 177
- 178 VMware, Inc 178
- VMware, Inc. 179 179
- 180 VMware, Inc 180
- VMware, Inc. 181 181
- 182 VMware, Inc 182
- VMware, Inc. 183 183
- 184 VMware, Inc 184
- VMware, Inc. 185 185
- 186 VMware, Inc 186
- Transferring Files and Text 187
- Between the Host and 187
- 188 VMware, Inc 188
- VMware, Inc. 189 189
- Using Shared Folders 190
- Set Up Shared Folders 191
- 192 VMware, Inc 192
- VMware, Inc. 193 193
- 194 VMware, Inc 194
- Viewing a Shared Folder 195
- Performance Improvements 196
- Folder Mounting 197
- Using a Mapped Drive 198
- VMware, Inc. 199 199
- 200 VMware, Inc 200
- Preserving the State of a 201
- Virtual Machine 201
- 202 VMware, Inc 202
- Using Snapshots 203
- Snapshots in a Process Tree 204
- Snapshot Relationships 204
- Snapshot Conflicts 206
- VMware, Inc. 207 207
- Snapshot Manager Overview 208
- Take a Snapshot 209
- 210 VMware, Inc 210
- Revert at Power Off 211
- 212 VMware, Inc 212
- VMware, Inc. 213 213
- Using AutoProtect Snapshots 214
- VMware, Inc. 215 215
- 216 VMware, Inc 216
- Cloning, Moving, and 217
- Sharing Virtual Machines 217
- 218 VMware, Inc 218
- Cloning a Virtual Machine 219
- Types of Clones 220
- Creating Clones 221
- 222 VMware, Inc 222
- Moving a Virtual Machine 223
- Processors 224
- VMware, Inc. 225 225
- 226 VMware, Inc 226
- Moving Linked Clones 227
- 228 VMware, Inc 228
- VMware, Inc. 229 229
- Web Server 230
- VMware, Inc. 231 231
- Start and Exit VMware Player 232
- VMware, Inc. 233 233
- 234 VMware, Inc 234
- Using Disks and Disk Drives 235
- Portability 236
- Disk Size and Files 236
- Lock Files 236
- IDE and SCSI Disk Types 237
- Physical Disks 238
- Defragment Virtual Disks 239
- Compact a Virtual Disk 240
- Expand a Virtual Disk 240
- VMware, Inc. 241 241
- 242 VMware, Inc 242
- VMware, Inc. 243 243
- 244 VMware, Inc 244
- VMware, Inc. 245 245
- 246 VMware, Inc 246
- VMware, Inc. 247 247
- 248 VMware, Inc 248
- VMware, Inc. 249 249
- 250 VMware, Inc 250
- VMware, Inc. 251 251
- 252 VMware, Inc 252
- Forafloppydrive: 253
- Legacy Virtual Disks 254
- VMware, Inc. 255 255
- 256 VMware, Inc 256
- Recording and Replaying 257
- Virtual Machine Activity 257
- 258 VMware, Inc 258
- VMware, Inc. 259 259
- 260 VMware, Inc 260
- VMware, Inc. 261 261
- 262 VMware, Inc 262
- VMware, Inc. 263 263
- Create a Recording 264
- Replay a Recording 265
- Browse a Recording 266
- VMware, Inc. 267 267
- Delete a Recording 268
- Disable Periodic Screenshots 269
- 270 VMware, Inc 270
- Configuring Teams 271
- Managing Teams 272
- VMware, Inc. 273 273
- Chapter 13 Configuring Teams 273
- Rename a Team 274
- Power Off or Close a Team 274
- Delete a Team 275
- VMware, Inc. 277 277
- 278 VMware, Inc 278
- Power On a Team 279
- Suspend or Resume a Team 279
- Working with Team Networks 280
- Create a Team LAN Segment 281
- Configure LAN Segments 281
- 282 VMware, Inc 282
- Delete a LAN Segment 283
- 284 VMware, Inc 284
- Configuring a Virtual 285
- DHCP Server 286
- Network Adapter 286
- Bridged Networking 287
- Set Up Bridged Networking 288
- VMware, Inc. 289 289
- Setting Up NAT 290
- Set Up Host-Only Networking 291
- 292 VMware, Inc 292
- VMware, Inc. 293 293
- 294 VMware, Inc 294
- Add Virtual Network Adapters 295
- 296 VMware, Inc 296
- Adapters 297
- Switches 298
- VMware, Inc. 299 299
- /usr/bin/vmware-netcfg 300
- VMware, Inc. 301 301
- 302 VMware, Inc 302
- Advanced Virtual 303
- Networking 303
- Configuration 304
- Addresses 305
- Range Address Use Example 306
- VMware, Inc. 307 307
- Avoiding MAC Address Changes 308
- VMware, Inc. 309 309
- 310 VMware, Inc 310
- Workstation 311
- DHCP and DDNS 311
- 312 VMware, Inc 312
- Set Up Using Configuration 3 313
- 314 VMware, Inc 314
- VMware, Inc. 315 315
- Using NAT 316
- DHCP on the NAT Network 317
- DNS on the NAT Network 318
- Advanced NAT Configuration 319
- 320 VMware, Inc 320
- VMware, Inc. 321 321
- 322 VMware, Inc 322
- VMware, Inc. 323 323
- Considerations for Using NAT 324
- Using NAT with NetLogon 324
- VMware, Inc. 325 325
- 326 VMware, Inc 326
- Sample Linux nat.conf File 327
- Using Samba with Workstation 328
- VMware, Inc. 329 329
- /etc/samba/smb.conf 330
- Connecting Devices 331
- 332 VMware, Inc 332
- VMware, Inc. 333 333
- Chapter 16 Connecting Devices 333
- 334 VMware, Inc 334
- Using Serial Ports 335
- 336 VMware, Inc 336
- VMware, Inc. 337 337
- 338 VMware, Inc 338
- Configuring Keyboard Features 339
- Hot Keys for Virtual Machines 340
- VMware, Inc. 341 341
- 342 VMware, Inc 342
- VMware, Inc. 343 343
- 344 VMware, Inc 344
- VMware, Inc. 345 345
- 346 VMware, Inc 346
- V-Scan Code Table 347
- 348 VMware, Inc 348
- VMware, Inc. 349 349
- 350 VMware, Inc 350
- VMware, Inc. 351 351
- 352 VMware, Inc 352
- Connecting USB Devices 353
- Connect a USB Device Manually 354
- VMware, Inc. 355 355
- 356 VMware, Inc 356
- VMware, Inc. 357 357
- 358 VMware, Inc 358
- VMware, Inc. 359 359
- Disable Smart Card Sharing 360
- VMware, Inc. 361 361
- 362 VMware, Inc 362
- VMware, Inc. 363 363
- 364 VMware, Inc 364
- VMware, Inc. 365 365
- 366 VMware, Inc 366
- Virtual Processors 367
- 368 VMware, Inc 368
- Special-Purpose 369
- Configuration Options for 369
- Windows Hosts 369
- 370 VMware, Inc 370
- VMware, Inc. 371 371
- 372 VMware, Inc 372
- Virtual Key Codes 373
- 374 VMware, Inc 374
- Computer 375
- Virtual Machine Hot Key 376
- Host Operating System Hot Key 376
- VMware, Inc. 377 377
- 378 VMware, Inc 378
- VMware, Inc. 379 379
- Guest ACPI S1 Sleep 380
- Learning the Basics of 381
- VMware ACE 381
- Key Features of VMware ACE 382
- VMware ACE Terminology 383
- Administrative Workstation 384
- VMware, Inc. 385 385
- 386 VMware, Inc 386
- VMware, Inc. 387 387
- 388 VMware, Inc 388
- Setting and Using Policies 389
- Benefits of Using Policies 390
- VMware, Inc. 391 391
- Activation Settings 392
- Authentication Settings 393
- 394 VMware, Inc 394
- VMware, Inc. 395 395
- Set Activation Limit 396
- VMware, Inc. 397 397
- 398 VMware, Inc 398
- Setting Expiration Policies 399
- 400 VMware, Inc 400
- VMware, Inc. 401 401
- 402 VMware, Inc 402
- VMware, Inc. 403 403
- 404 VMware, Inc 404
- VMware, Inc. 405 405
- Add or Edit a Network Zone 406
- VMware, Inc. 407 407
- Toaddarule,clickAdd. 408
- Change NAT Settings 409
- 410 VMware, Inc 410
- VMware, Inc. 411 411
- Setting USB Device Policies 412
- VMware, Inc. 413 413
- 414 VMware, Inc 414
- Runtime Preferences Settings 415
- Exit Behavior Settings 416
- Pocket ACE Cache Settings 417
- Setting Snapshot Policies 418
- VMware, Inc. 419 419
- Setting Kiosk Mode Policies 420
- Instances 421
- 422 VMware, Inc 422
- VMware, Inc. 423 423
- 424 VMware, Inc 424
- Examples of Policy Scripts 425
- 426 VMware, Inc 426
- VMware, Inc. 427 427
- Hosts Only 428
- VMware, Inc. 429 429
- 430 VMware, Inc 430
- VMware, Inc. 431 431
- Shortcut Key Values 432
- Sample Skin File 433
- 434 VMware, Inc 434
- Deploying ACE Packages 435
- Encryption Settings 436
- Package Lifetime Settings 436
- VMware, Inc. 437 437
- 438 VMware, Inc 438
- VMware, Inc. 439 439
- 440 VMware, Inc 440
- VMware, Inc. 441 441
- 442 VMware, Inc 442
- Set Up a Remote Domain Join 443
- 444 VMware, Inc 444
- Custom EULA Settings 445
- ACE Resources Directory 446
- Settings 448
- Creating a Package 449
- 450 VMware, Inc 450
- VMware, Inc. 451 451
- 452 VMware, Inc 452
- Use the New Package Wizard 453
- 454 VMware, Inc 454
- VMware, Inc. 455 455
- Deploy Packages 456
- Pocket ACE 457
- Use Cases for Pocket ACE 458
- Portable Device Requirements 459
- Create a Pocket ACE Package 460
- VMware, Inc. 461 461
- Chapter 21 Pocket ACE 461
- 462 VMware, Inc 462
- Run the Pocket ACE Instance 463
- 464 VMware, Inc 464
- Installing ACE Packages 465
- 466 VMware, Inc 466
- VMware, Inc. 467 467
- 468 VMware, Inc 468
- VMware-Player-i386.bundle 469
- VMware-Player-x86_64.bundle 469
- 470 VMware, Inc 470
- ./vmware-install.pl 471
- 472 VMware, Inc 472
- VMware, Inc. 473 473
- Start and Use an ACE Instance 474
- VMware, Inc. 475 475
- 476 VMware, Inc 476
- VMware, Inc. 477 477
- Install an ACE Client License 478
- Quit VMware Player 479
- Troubleshooting Tools 479
- Password Prompts 480
- Respond to Hot Fix Requests 481
- Troubleshooting Setup Issues 482
- VMware, Inc. 483 483
- 484 VMware, Inc 484
- Appendix: Workstation 485
- Command-Line Reference 485
- 486 VMware, Inc 486
- Me\Windows Me.vmx" 487
- 488 VMware, Inc 488
- Glossary 489
- G GotoSnapshot 490
- H–K host‐onlynetworking 490
- L–M LANsegment 491
- N–O nonpersistentmode 491
- P parent 491
- Q quickswitchmode 492
- R rawdisk 492
- S sharedfolder 492
- T–U team 493
- V–X virtualdisk 493
- 494 VMware, Inc 494
- Numerics 495
- 496 VMware, Inc 496
- VMware, Inc. 497 497
- 498 VMware, Inc 498
- VMware, Inc. 499 499
- 500 VMware, Inc 500
- VMware, Inc. 501 501
- 502 VMware, Inc 502
- VMware, Inc. 503 503
- 504 VMware, Inc 504
- VMware, Inc. 505 505
- 506 VMware, Inc 506
- VMware, Inc. 507 507
- 508 VMware, Inc 508
- VMware, Inc. 509 509
- 510 VMware, Inc 510
- VMware, Inc. 511 511
- 512 VMware, Inc 512
Produits connexes et manuels pour Logiciel de gestion du système VMware Workstation 7
Logiciel de gestion du système VMware VIEW COMPOSER 2.5 - ARCHITECTURE Manuel d'utilisateur
(63 pages)
(63 pages)
Logiciel de gestion du système VMware ESX 4.0 - GETTING STARTED UPDATE 1 Guide d'installation
(370 pages)
(370 pages)
Logiciel de gestion du système VMware VSHIELD MANAGER 4.1.0 UPDATE 1 - API Manuel d'utilisateur
(162 pages)
(162 pages)
© 2020, manymanuals.fr. Tous droits réservés | 0.306 s |
Manymanuals.com
Manymanuals.de
Manymanuals.fr
Manymanuals.it
Manymanuals.pl
Manymanuals.cz
Manymanuals.es
Manymanuals-pt.com
Commentaires sur ces manuels